Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Contact us: [email protected]

Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody

20-abx130708
  • EUR 376.80
  • EUR 159.60
  • EUR 978.00
  • EUR 510.00
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-400ul 400 ul
EUR 627.6

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-80l 80 µl
EUR 343.2

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx230851-100ug 100 ug
EUR 577.2

Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1)

4-RPE246Hu01
  • EUR 582.34
  • EUR 279.60
  • EUR 1853.76
  • EUR 697.92
  • EUR 1275.84
  • EUR 465.60
  • EUR 4454.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

20-abx150797
  • EUR 8853.60
  • EUR 4719.60
  • EUR 1093.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-10x96wellstestplate 10x96-wells test plate
EUR 5677.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x48wellstestplate 1x48-wells test plate
EUR 572.76
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x96wellstestplate 1x96-wells test plate
EUR 766.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-5x96wellstestplate 5x96-wells test plate
EUR 3090.6
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

ELI-10937h 96 Tests
EUR 988.8

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

20-abx650585
  • EUR 811.20
  • EUR 343.20
  • EUR 2498.40
  • EUR 961.20
  • EUR 577.20
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

ELI-11036m 96 Tests
EUR 1038

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

20-abx494551
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

ELK4791 1 plate of 96 wells
EUR 518.4
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

4-SEE246Hu
  • EUR 5738.40
  • EUR 3031.20
  • EUR 768.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

4-PAE246Hu01
  • EUR 296.40
  • EUR 3012.00
  • EUR 750.00
  • EUR 372.00
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

4-PAE246Hu01-APC
  • EUR 414.00
  • EUR 3930.00
  • EUR 1094.40
  • EUR 528.00
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

4-PAE246Hu01-Biotin
  • EUR 373.20
  • EUR 2952.00
  • EUR 872.40
  • EUR 457.20
  • EUR 262.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

4-PAE246Hu01-Cy3
  • EUR 502.80
  • EUR 5190.00
  • EUR 1410.00
  • EUR 654.00
  • EUR 301.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

4-PAE246Hu01-FITC
  • EUR 355.20
  • EUR 3168.00
  • EUR 900.00
  • EUR 446.40
  • EUR 234.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

4-PAE246Hu01-HRP
  • EUR 379.20
  • EUR 3426.00
  • EUR 968.40
  • EUR 477.60
  • EUR 247.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

4-PAE246Hu01-PE
  • EUR 355.20
  • EUR 3168.00
  • EUR 900.00
  • EUR 446.40
  • EUR 234.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

abx392200-96tests 96 tests
EUR 1093.2

Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx391017-96tests 96 tests
EUR 1093.2

Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx388677-96tests 96 tests
EUR 1093.2

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

4-PAE246Hu01-APC-Cy7
  • EUR 685.20
  • EUR 7716.00
  • EUR 2046.00
  • EUR 912.00
  • EUR 382.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

20-abx310811
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

20-abx310812
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

20-abx310813
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

20-abx310814
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Human beta carotene

QY-E05643 96T
EUR 433.2

beta-Carotene

GP8334-10G 10 g
EUR 122.4

beta-Carotene

GP8334-1G 1 g
EUR 57.6

beta-Carotene

GP8334-25G 25 g
EUR 208.8

beta-Carotene

GP8334-5G 5 g
EUR 88.8

Beta-Carotene

TB0299 8XX100mg
EUR 328.8

Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

ELISA-1 1
EUR 242.4

Bcmo1/ Rat Bcmo1 ELISA Kit

ELI-33406r 96 Tests
EUR 1063.2

Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx250481-96tests 96 tests
EUR 801.6

Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

EH1224 96T
EUR 681.12
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

EK2713 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

ELI-49386h 96 Tests
EUR 988.8

Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0265Hu 1 Kit
EUR 726

Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx515122-96tests 96 tests
EUR 886.8

Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0170Mo 1 Kit
EUR 758.4

Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

ELI-49387m 96 Tests
EUR 1038

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 572.4

BCMO1 ELISA Kit (Human) (OKCD04382)

OKCD04382 96 Wells
EUR 997.2
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 96 Well Plate
EUR 572.4

Chicken BCMO1 ELISA KIT

ELI-25375c 96 Tests
EUR 1113.6

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

20-abx003844
  • EUR 493.20
  • EUR 710.40
  • EUR 218.40
  • EUR 376.80
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx122472-100ug 100 ug
EUR 469.2

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx230852-100ug 100 ug
EUR 577.2

YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

PROTP31946-1 Regular: 25ug
EUR 380.4
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 96 Well Plate
EUR 572.4

β-Carotene

HY-N0411 50mg
EUR 129.6

alpha-Carotene

TBZ2607 5mg Ask for price

Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx385151-96tests 96 tests
EUR 1093.2

Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23191h 96 Tests
EUR 988.8

ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

EXOAB-KIT-1 25 ul each
EUR 752.4

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

20-abx151570
  • EUR 8853.60
  • EUR 4719.60
  • EUR 1093.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

abx381498-96tests 96 tests
EUR 1093.2

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-48T 48T
EUR 620.4
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-96T 96T
EUR 807.6
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-10x96wellstestplate 10x96-wells test plate
EUR 5677.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x48wellstestplate 1x48-wells test plate
EUR 572.76
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x96wellstestplate 1x96-wells test plate
EUR 766.8
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-5x96wellstestplate 5x96-wells test plate
EUR 3090.6
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

4-SEF458Hu
  • EUR 5738.40
  • EUR 3031.20
  • EUR 768.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-48Tests 48 Tests
EUR 652.8

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-96Tests 96 Tests
EUR 907.2

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-48Tests 48 Tests
EUR 625.2

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-96Tests 96 Tests
EUR 867.6

mRNAExpress mRNA Synthesis kit (5 reactions)

MR-KIT-1 5 reactions
EUR 1382.4

BCMO1 siRNA

20-abx909008
  • EUR 661.20
  • EUR 878.40
  • 15 nmol
  • 30 nmol

BCMO1 siRNA

20-abx909009
  • EUR 661.20
  • EUR 878.40
  • 15 nmol
  • 30 nmol

PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN320A-KIT 1 Kit
EUR 5929.2

Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

201-12-2419 96 tests
EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human SQLE/ Squalene monooxygenase ELISA Kit

E2385Hu 1 Kit
EUR 726

Kynurenine 3-monooxygenase ELISA Kit|Human

EF005180 96 Tests
EUR 826.8

Human Alkylglycerol monooxygenase, AGMO ELISA KIT

ELI-24195h 96 Tests
EUR 988.8

Human Squalene monooxygenase, SQLE ELISA KIT

ELI-32784h 96 Tests
EUR 988.8

Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E01119 96T
EUR 433.2

PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN340iPS-KIT 1 Kit
EUR 5929.2

Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

EM5001-1 96 Well Plate
EUR 500.4

Human BCMO1 shRNA Plasmid

20-abx959976
  • EUR 961.20
  • EUR 1345.20
  • 150 µg
  • 300 µg

BCMO1 Recombinant Protein (Human)

RP036973 100 ug Ask for price

BCMO1 Recombinant Protein (Human)

RP036976 100 ug Ask for price

Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx391608-96tests 96 tests
EUR 1093.2

Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx389876-96tests 96 tests
EUR 1093.2

Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23404c 96 Tests
EUR 1113.6

Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

ELI-45646m 96 Tests
EUR 1038

Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-42078p 96 Tests
EUR 1113.6

Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

EF015513 96 Tests
EUR 826.8

MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

EF012392 96 Tests
EUR 826.8

Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

EF018966 96 Tests
EUR 826.8

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

abx332554-100ul 100 ul
EUR 510

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx329250
  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241015
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241094
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214774
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214826
  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

ELK4594 1 plate of 96 wells
EUR 518.4
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

ELI-43781h 96 Tests
EUR 988.8

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 380.4
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0177302 1.0 ug DNA
EUR 184.8

T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents)

CAS510A-KIT 1 Kit
EUR 966

PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1)

PIN300A-KIT 1 Kit
EUR 3357.6

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

20-abx152142
  • EUR 8853.60
  • EUR 4719.60
  • EUR 1093.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Kynurenine 3-monooxygenase (KMO) ELISA Kit

abx573591-96tests 96 tests
EUR 801.6

Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit

abx386638-96tests 96 tests
EUR 1093.2

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

DLR-KMO-Hu-48T 48T
EUR 620.4
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit